Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAryl Hydrocarbon Receptor (AhR)
LigandBDBM23926
Substrate/CompetitorBDBM23927
Meas. Tech.In Vitro Binding Assay
pH7.6±n/a
Temperature277.15±n/a K
Ki 169±5.2 nM
CommentsAntagonist.
Citation de Medina, PCasper, RSavouret, JFPoirot, M Synthesis and biological properties of new stilbene derivatives of resveratrol as new selective aryl hydrocarbon modulators. J Med Chem48:287-91 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aryl Hydrocarbon Receptor (AhR)
Name:Aryl Hydrocarbon Receptor (AhR)
Synonyms:Dioxin receptor
Type:Transcription factor
Mol. Mass.:94428.00
Organism:Oryctolagus cuniculus (rabbit)
Description:Cytosols from rabbit liver were used in binding assay.
Residue:847
Sequence:
MNGGGANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSSADRNGGQDPCRAKFGEGLNLQEGEFLLQA
LNGFVLVVTVDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPS
QCTDPGQGADETHGLPQPVYYNPDQLPPENSSFMERCFICRLRCLLDNSSGFLAMNFQGR
LKFLHGQNKKGKDGSLLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPTGCDA
KGQIVLGYTEAELCMRGSGYQFIHAADMLYCAESHIRMIKTGESGLAVFRLLTKDNRWAW
VQSNARFIYKNGRPDFIIATQRPLTDEEGREHLLKRNTKLPFMFTTGEAVLYEMTSPFPP
IMDPLPIRPKSGTCGKDSATKPTPSKDSVHPSSLLSALMQQDESIYLYPPSSNAPFERNF
FTESLNECSNWPENVASVAGGSVLKHEQIGQSQEVSPAFSGDQTVLFPDNKNCDLYNIMK
NLGVDFEDIKNMQNEEFFGADFSGEVDFRDIDITDEILTYVQDSLNKSPFGSPGYQPQPA
TALNSSCMVQERLQLGPPQQPPCRSEQATVEPQQQLCQKMEHMQVNSMFANWSANQPVPF
SEPQQDLQPYSVFTDFHTADQAFPYTAAMNTMPYTQNFTPCNQTVAPQHSRCTQLDFAMG
NFDSSPYPSTSNLEDFVTCLQVPDRQTHGGNPQSAMVAPQTCYAGAVSMYQCQPGPAHTL
MGQMQCEPPVPGPEAFLNKFPNGGMLNETYPADLHDINNTVASTHLPPLHHPSEARPFPD
LASGRLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23926
NameBDBM23926
Synonyms:(E)-resveratrol | 5-[(E)-2-(4-hydroxyphenyl)ethenyl]benzene-1,3-diol | CHEMBL165 | Resveratol | Stilbene, 2f | cid_445154 | resveratrol | trans-resveratrol
TypeSmall organic molecule
Emp. Form.C14H12O3
Mol. Mass.228.2433
SMILESOc1ccc(\C=C\c2cc(O)cc(O)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM23927
NameBDBM23927
Synonyms:2,3,7,8-Tetrachlorodibenzo-p-dioxin | 2,3,7,8-tetrachlorooxanthrene | Tetrachlorodibenzodioxin | [3H]-TCDD
Typeradiolabeled ligand
Emp. Form.C12H4Cl4O2
Mol. Mass.321.971
SMILESClc1cc2Oc3cc(Cl)c(Cl)cc3Oc2cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: