Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
LigandBDBM24092
Substrate/CompetitorBDBM2
Meas. Tech.Kinesin ATPase In Vitro Assay
pH7±n/a
Temperature296.15±n/a K
IC50 16.5±n/a nM
Citation Roecker, AJColeman, PJMercer, SPSchreier, JDBuser, CAWalsh, ESHamilton, KLobell, RBTao, WDiehl, RESouth, VJDavide, JPKohl, NEYan, YKuo, LCLi, CFernandez-Metzler, CMahan, EAPrueksaritanont, THartman, GD Kinesin spindle protein (KSP) inhibitors. Part 8: Design and synthesis of 1,4-diaryl-4,5-dihydropyrazoles as potent inhibitors of the mitotic kinesin KSP. Bioorg Med Chem Lett17:5677-82 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Name:A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Synonyms:ADAMTS5 | Aggrecanase-2 | Metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)
Type:Enzyme
Mol. Mass.:101769.09
Organism:Homo sapiens (Human)
Description:Q9UNA0
Residue:930
Sequence:
MLLGWASLLLCAFRLPLAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGH
PHPLAQRRRSKGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGT
SAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGR
VYGDGSARILHVYTREGFSFEALPPRASCETPASTPEAHEHAPAHSNPSGRAALASQLLD
QSALSPAGGSGPQTWWRRRRRSISRARQVELLLVADASMARLYGRGLQHYLLTLASIANR
LYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYD
AAILFTREDLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSH
DDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQI
LGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGT
PCGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPR
NNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVL
PADVCKLTCRAKGTGYYVVFSPKVTDGTECRLYSNSVCVRGKCVRTGCDGIIGSKLQYDK
CGVCGGDNSSCTKIVGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKKK
NGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPT
KPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTV
QCQDGNRKLAKGCPLSQRPSAFKQCLLKKC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24092
NameBDBM24092
Synonyms:1,4-diaryl-4,5-dihydropyrazole, 12 | 4-{3-[1-(2,5-difluorophenyl)-3-acetyl-4-phenyl-4,5-dihydro-1H-pyrazol-4-yl]propyl}-1,4-thiomorpholine-1,1-dione | Racemate
TypeSmall organic molecule
Emp. Form.C24H27F2N3O3S
Mol. Mass.475.551
SMILESCC(=O)C1=NN(CC1(CCCN1CCS(=O)(=O)CC1)c1ccccc1)c1cc(F)ccc1F |t:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM2
NameBDBM2
Synonyms:({[({[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}(hydroxy)phosphoryl)oxy](hydroxy)phosphoryl}oxy)phosphonic acid | ATP | Brimonidine ATP | CHEMBL14249
TypeNucleoside or nucleotide
Emp. Form.C10H16N5O13P3
Mol. Mass.507.181
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: