Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase JAK1 [837-1142]
LigandBDBM380444
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
IC50<300±n/a nM
Citation Li, YZhuo, JMei, S Bipyrazole derivatives as JAK inhibitors US Patent US9926301 Publication Date 3/27/2018
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase JAK1 [837-1142]
Name:Tyrosine-protein kinase JAK1 [837-1142]
Synonyms:JAK1 (aa 837-1142) | Tyrosine-protein kinase JAK1 | Tyrosine-protein kinase JAK1 (837-1142) | Tyrosine-protein kinase JAK1 (aa 837-1142)
Type:n/a
Mol. Mass.:35230.04
Organism:Homo sapiens (Human)
Description:P23458[837-1142]
Residue:306
Sequence:
FFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDP
EGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIM
EFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQ
VKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLT
YCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQP
SNRTSF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM380444
NameBDBM380444
Synonyms:5-[3-(Cyanomethyl)-3-(3′,5′-dimethyl-1H,1′H-4,4′-bipyrazol-1-yl)azetidin-1-yl]-N-isopropylpyrazine-2-carboxamide | US10435392, Example 8 | US9926301, Example 8
TypeSmall organic molecule
Emp. Form.C21H25N9O
Mol. Mass.419.4829
SMILESCC(C)NC(=O)c1cnc(cn1)N1CC(CC#N)(C1)n1cc(cn1)-c1c(C)n[nH]c1C
Structure
n/a