Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetJAK2 (aa 828-1132)
LigandBDBM380446
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
IC50>700±n/a nM
Citation Li, YZhuo, JMei, S Bipyrazole derivatives as JAK inhibitors US Patent US9926301 Publication Date 3/27/2018
More Info.:Get all data from this article,  Assay Method
 
JAK2 (aa 828-1132)
Name:JAK2 (aa 828-1132)
Synonyms:Tyrosine-protein kinase JAK2
Type:n/a
Mol. Mass.:35579.28
Organism:Homo sapiens (Human)
Description:n/a
Residue:305
Sequence:
GALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHS
TEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKER
IDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEY
YKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGN
DKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIR
DNMAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM380446
NameBDBM380446
Synonyms:5-[3-(Cyanomethyl)-3-(3-methyl-1H,1′H-4,4′-bipyrazol-1-yl)azetidin-1-yl]-N-isopropylpyrazine-2-carboxamide trifluoroacetate | US10435392, Example 10 | US9926301, Example 10
TypeSmall organic molecule
Emp. Form.C20H23N9O
Mol. Mass.405.4563
SMILESCC(C)NC(=O)c1cnc(cn1)N1CC(CC#N)(C1)n1cc(c(C)n1)-c1cn[nH]c1
Structure
n/a