Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I isoform alpha
LigandBDBM25017
Substrate/CompetitorCK1 Substrate Peptide
Meas. Tech.Kinase Inhibition Assay
IC50 450±n/a nM
Citation Sapkota, GPCummings, LNewell, FSArmstrong, CBain, JFrodin, MGrauert, MHoffmann, MSchnapp, GSteegmaier, MCohen, PAlessi, DR BI-D1870 is a specific inhibitor of the p90 RSK (ribosomal S6 kinase) isoforms in vitro and in vivo. Biochem J401:29-38 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Casein kinase I isoform alpha
Name:Casein kinase I isoform alpha
Synonyms:CK1 | CKI-alpha | CSNK1A1 | Casein Kinase I | Casein kinase 1 alpha (CK1 alpha)
Type:Serine/threonine-protein kinase
Mol. Mass.:38936.59
Organism:Homo sapiens (Human)
Description:P48729
Residue:337
Sequence:
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25017
NameBDBM25017
Synonyms:2-[(3,5-difluoro-4-hydroxyphenyl)amino]-5,7-dimethyl-8-(3-methylbutyl)-5,6,7,8-tetrahydropteridin-6-one | BI-D1870
TypeSmall organic molecule
Emp. Form.C19H23F2N5O2
Mol. Mass.391.415
SMILESCC(C)CCN1C(C)C(=O)N(C)c2cnc(Nc3cc(F)c(O)c(F)c3)nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
CK1 Substrate Peptide
Name:CK1 Substrate Peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:2127.71
Organism:n/a
Description:n/a
Residue:18
Sequence:
RRKDLHDDEEDEAMSITA