Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetG-protein coupled receptor 6
LigandBDBM382120
Substrate/Competitorn/a
Meas. Tech.A.1 Inhibition of cAMP Activity of GPR6 In Vitro Assay
EC50 184000±n/a nM
Citation Adams, MEBrown, JWHitchcock, SHopkins, MKikuchi, SLam, BMonenschein, HReichard, HSun, H Pyrazines as modulators of GPR6 US Patent US10273225 Publication Date 4/30/2019
More Info.:Get all data from this article,  Assay Method
 
G-protein coupled receptor 6
Name:G-protein coupled receptor 6
Synonyms:G-protein coupled receptor 6 (GPR6) | GPR6 | Sphingosine 1-phosphate receptor GPR6
Type:Protein
Mol. Mass.:37886.39
Organism:Homo sapiens (Human)
Description:P46095
Residue:362
Sequence:
MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQL
SAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLL
AGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRR
TLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGI
MLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCV
VGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPS
EV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM382120
NameBDBM382120
Synonyms:5-(4-(4-chloro-2-fluorophenoxy)piperidin-1-yl)-6-(cyclopropylamino)pyrazine-2-carbonitrile | US10000468, Example 29 | US10273225, Example 29
TypeSmall organic molecule
Emp. Form.C19H19ClFN5O
Mol. Mass.387.838
SMILESFc1cc(Cl)ccc1OC1CCN(CC1)c1ncc(nc1NC1CC1)C#N
Structure
n/a