Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP Phosphoribosyltransferase
LigandBDBM25314
Substrate/CompetitorBDBM25315
Meas. Tech.Enzyme Inhibition Assay
pH8.5±n/a
Temperature295.15±n/a K
IC50 4000±n/a nM
Comments76% inhibition @ 10 uM.
Citation Cho, YIoerger, TRSacchettini, JC Discovery of novel nitrobenzothiazole inhibitors for Mycobacterium tuberculosis ATP phosphoribosyl transferase (HisG) through virtual screening. J Med Chem51:5984-92 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
ATP Phosphoribosyltransferase
Name:ATP Phosphoribosyltransferase
Synonyms:ATP-PRT | ATP-PRTase | hisG
Type:Glycosyltransferase
Mol. Mass.:30473.85
Organism:Mycobacterium tuberculosis
Description:n/a
Residue:284
Sequence:
MLRVAVPNKGALSEPATEILAEAGYRRRTDSKDLTVIDPVNNVEFFFLRPKDIAIYVGSG
ELDFGITGRDLVCDSGAQVRERLALGFGSSSFRYAAPAGRNWTTADLAGMRIATAYPNLV
RKDLATKGIEATVIRLDGAVEISVQLGVADAIADVVGSGRTLSQHDLVAFGEPLCDSEAV
LIERAGTDGQDQTEARDQLVARVQGVVFGQQYLMLDYDCPRSALKKATAITPGLESPTIA
PLADPDWVAIRALVPRRDVNGIMDELAAIGAKAILASDIRFCRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25314
NameBDBM25314
Synonyms:2-[(5,6-diphenyl-1,2,4-triazin-3-yl)sulfanyl]-N-(1,3-thiazol-2-yl)acetamide | ChemBridge 1,2,4-triazine, 4
TypeSmall organic molecule
Emp. Form.C20H15N5OS2
Mol. Mass.405.496
SMILESO=C(CSc1nnc(-c2ccccc2)c(n1)-c1ccccc1)Nc1nccs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM25315
NameBDBM25315
Synonyms:Phosphoribosyl Pyrophosphate (PRPP) | {[(2R,3S,4R,5R)-3,4-dihydroxy-5-{[hydroxy(phosphonooxy)phosphoryl]oxy}oxolan-2-yl]methoxy}phosphonic acid
Type Pentosephosphate
Emp. Form.C5H13O14P3
Mol. Mass.390.0696
SMILESO[C@H]1[C@@H](O)[C@@H](OP(O)(=O)OP(O)(O)=O)O[C@@H]1COP(O)(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: