Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP Phosphoribosyltransferase
LigandBDBM25318
Substrate/CompetitorBDBM25315
Meas. Tech.Enzyme Inhibition Assay
pH8.5±n/a
Temperature295.15±n/a K
IC50 10000±n/a nM
Comments50% inhibition @ 10 uM.
Citation Cho, YIoerger, TRSacchettini, JC Discovery of novel nitrobenzothiazole inhibitors for Mycobacterium tuberculosis ATP phosphoribosyl transferase (HisG) through virtual screening. J Med Chem51:5984-92 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
ATP Phosphoribosyltransferase
Name:ATP Phosphoribosyltransferase
Synonyms:ATP-PRT | ATP-PRTase | hisG
Type:Glycosyltransferase
Mol. Mass.:30473.85
Organism:Mycobacterium tuberculosis
Description:n/a
Residue:284
Sequence:
MLRVAVPNKGALSEPATEILAEAGYRRRTDSKDLTVIDPVNNVEFFFLRPKDIAIYVGSG
ELDFGITGRDLVCDSGAQVRERLALGFGSSSFRYAAPAGRNWTTADLAGMRIATAYPNLV
RKDLATKGIEATVIRLDGAVEISVQLGVADAIADVVGSGRTLSQHDLVAFGEPLCDSEAV
LIERAGTDGQDQTEARDQLVARVQGVVFGQQYLMLDYDCPRSALKKATAITPGLESPTIA
PLADPDWVAIRALVPRRDVNGIMDELAAIGAKAILASDIRFCRF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25318
NameBDBM25318
Synonyms:(4-methoxyphenyl)methyl 2-methyl-5-oxo-4,7-bis(thiophen-2-yl)-1,4,5,6,7,8-hexahydroquinoline-3-carboxylate | ChemBridge hexahydroquinoline-3-carboxylate, 10
Typen/a
Emp. Form.C27H25NO4S2
Mol. Mass.491.622
SMILESCOc1ccc(COC(=O)C2=C(C)N=C3CC(CC(=O)C3C2c2cccs2)c2cccs2)cc1 |c:10,t:13|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM25315
NameBDBM25315
Synonyms:Phosphoribosyl Pyrophosphate (PRPP) | {[(2R,3S,4R,5R)-3,4-dihydroxy-5-{[hydroxy(phosphonooxy)phosphoryl]oxy}oxolan-2-yl]methoxy}phosphonic acid
Type Pentosephosphate
Emp. Form.C5H13O14P3
Mol. Mass.390.0696
SMILESO[C@H]1[C@@H](O)[C@@H](OP(O)(=O)OP(O)(O)=O)O[C@@H]1COP(O)(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: