Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpoxide Hydrolase B (EHB)
LigandBDBM25730
Substrate/CompetitorBDBM25726
Meas. Tech.Mtb EHB Inhibition Assay
pH7±n/a
Temperature303.15±n/a K
IC50 220±n/a nM
Citation Biswal, BKMorisseau, CGaren, GCherney, MMGaren, CNiu, CHammock, BDJames, MN The molecular structure of epoxide hydrolase B from Mycobacterium tuberculosis and its complex with a urea-based inhibitor. J Mol Biol381:897-912 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Epoxide Hydrolase B (EHB)
Name:Epoxide Hydrolase B (EHB)
Synonyms:Mtb EHB
Type:Enzyme
Mol. Mass.:39285.78
Organism:Mycobacterium tuberculosis
Description:The His6-tagged Mtb EHB was expressed in E. coli and purified.
Residue:356
Sequence:
MSQVHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAI
DQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDR
CAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVWYQDYFAVQDGIITEIEE
DLRGWLLGLTYTVSGEGMMAATKAAVDAGVDLESMDPIDVIRAGPLCMAEGARLKDAFVY
PETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQ
YDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25730
NameBDBM25730
Synonyms:3-(4-chlorophenyl)-1-(3,4-dichlorophenyl)urea | US8815951, 3-(4-chlorophenyl)-1-(3,4-dichlorophenyl)urea | Urea-based compound, 11 | cid_7547
TypeSmall organic molecule
Emp. Form.C13H9Cl3N2O
Mol. Mass.315.582
SMILESClc1ccc(NC(=O)Nc2ccc(Cl)c(Cl)c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM25726
NameBDBM25726
Synonyms:2-(6-methoxynaphthalen-2-yl)-2-({[(3-phenyloxiran-2-yl)methoxy]carbonyl}oxy)acetonitrile | alpha-cyanocarbonate epoxide | cyano(6-methoxy-naphthalen-2-yl)methyl trans-[(3-phenyloxiran-2-yl)methyl] carbonate
TypeSmall organic molecule
Emp. Form.C23H19NO5
Mol. Mass.389.4007
SMILESCOc1ccc2cc(ccc2c1)C(OC(=O)OCC1OC1c1ccccc1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: