Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein phosphatase (VHR)
LigandBDBM26104
Substrate/CompetitorBDBM13466
Meas. Tech.Determination of Inhibitor Ki
pH7.4±n/a
Temperature295.15±n/a K
Ki>50000±n/a nM
Citation Soellner, MBRawls, KAGrundner, CAlber, TEllman, JA Fragment-based substrate activity screening method for the identification of potent inhibitors of the Mycobacterium tuberculosis phosphatase PtpB. J Am Chem Soc129:9613-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dual specificity protein phosphatase (VHR)
Name:Dual specificity protein phosphatase 3
Synonyms:Dual specificity protein phosphatase 3 | Dual specificity protein phosphatase VHR | Protein Tyrosine Phosphatase VHR | Tyrosine-protein phosphatase non-receptor type 1 | VHR
Type:Hydrolase
Mol. Mass.:20480.58
Organism:Homo sapiens (Human)
Description:n/a
Residue:185
Sequence:
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26104
NameBDBM26104
Synonyms:5-{2-cyclohexyl-4-[4-fluoro-3-(trifluoromethyl)phenyl]phenyl}-1,2-oxazole-3-carboxylic acid | Isoxazole carboxylic acid, 19
TypeSmall organic molecule
Emp. Form.C23H19F4NO3
Mol. Mass.433.3955
SMILESOC(=O)c1cc(on1)-c1ccc(cc1C1CCCCC1)-c1ccc(F)c(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM13466
NameBDBM13466
Synonyms:4-Nitrophenyl phosphate disodium salt hexahydrate | 4-nitrophenyl phosphate (pNPP) | disodium (4-nitrophenyl) phosphate | para-nitrophenyl phosphate (pNPP)
TypeSmall organic molecule
Emp. Form.C6H4NO6P
Mol. Mass.217.0739
SMILES[O-][N+](=O)c1ccc(O[P+]([O-])([O-])[O-])cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: