Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAP2-associated protein kinase 1
LigandBDBM263014
Substrate/Competitorn/a
Meas. Tech.AAK1 Kinase Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 652±n/a nM
Commentsextracted
Citation Vrudhula, VMDzierba, CDBronson, JJMacor, JENara, SJRajamani, RKaratholuvhu, MS Aryl amide-based kinase inhibitors US Patent US9708337 Publication Date 7/18/2017
More Info.:Get all data from this article,  Assay Method
 
AP2-associated protein kinase 1
Name:AP2-associated protein kinase 1
Synonyms:AAK1 | Adaptor-associated kinase 1 | KIAA1048
Type:PROTEIN
Mol. Mass.:103884.23
Organism:Homo sapiens
Description:ChEMBL_774569
Residue:961
Sequence:
MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIV
FLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVW
EVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVE
NILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIIT
TKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDK
RPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTT
ETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKP
QAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPP
AQQQPAGTFYQQQQAQTQQFQAVHPATQKPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQ
QQQQQQLATALHQQQLMTQQAALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQ
PKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAA
AEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDDDNFSKLTAEELLNKDFAKLG
EGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI
PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPV
PQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNL
ISGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLID
L
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM263014
NameBDBM263014
Synonyms:N-(5H-chromeno[3,4-c]pyridin-8-yl)propionamide | US9708337, 28
TypeSmall organic molecule
Emp. Form.C15H14N2O2
Mol. Mass.254.2839
SMILESCCC(=O)Nc1ccc-2c(OCc3cnccc-23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a