Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2
LigandBDBM26257
Substrate/CompetitorBDBM21190
Meas. Tech.Receptor Binding Assay
pH7.4±n/a
Temperature295.15±n/a K
Ki 1.9±0.2 nM
Citation Zhang, XTellew, JELuo, ZMoorjani, MLin, ELanier, MCChen, YWilliams, JPSaunders, JLechner, SMMarkison, SJoswig, TPetroski, RPiercey, JKargo, WMalany, SSantos, MGross, RSWen, JJalali, KO'Brien, ZStotz, CECrespo, MIDiaz, JLSlee, DH Lead Optimization of 4-Acetylamino-2-(3,5-dimethylpyrazol-1-yl)-6-pyridylpyrimidines as A2A Adenosine Receptor Antagonists for the Treatment of Parkinson's Disease. J Med Chem51:7099-7110 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Adenosine receptor A2
Name:Adenosine receptors; A1 & A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (Human)
Description:P29274
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26257
NameBDBM26257
Synonyms:N-[2-(3,5-dimethyl-1H-pyrazol-1-yl)-6-[6-(4-hydroxypiperidin-1-yl)pyridin-2-yl]pyrimidin-4-yl]acetamide | pyrazolylpyrimidine derivative, 16k
TypeSmall organic molecule
Emp. Form.C21H25N7O2
Mol. Mass.407.4689
SMILESCC(=O)Nc1cc(nc(n1)-n1nc(C)cc1C)-c1cccc(n1)N1CCC(O)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM21190
NameBDBM21190
Synonyms:4-(2-{[5-amino-2-(furan-2-yl)-[1,2,4]triazolo[1,5-a][1,3,5]triazin-7-yl]amino}ethyl)phenol | CHEMBL113142 | ZM 241385 | ZM241385 | [3H]-ZM241385
TypeSmall organic molecule
Emp. Form.C16H15N7O2
Mol. Mass.337.336
SMILESNc1nc(NCCc2ccc(O)cc2)nc2nc(nn12)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: