Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGhrelin receptor
LigandBDBM50370294
Substrate/Competitorn/a
Meas. Tech.HS-R1a radioreceptor assay
IC50 6.08±n/a nM
Citation Ong, HChemtob, SLubell, WSennlaub, FBoeglin, DProulx, CSajjadi, ZSabatino, D Azapeptides as CD36 binding compounds US Patent US9708370 Publication Date 7/18/2017
More Info.:Get all data from this article,  Assay Method
 
Ghrelin receptor
Name:Estrogen receptor alpha D538G
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:66173.42
Organism:Homo sapiens (Human)
Description:n/a
Residue:595
Sequence:
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYGLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50370294
NameBDBM50370294
Synonyms:Examorelin | HEXARELIN | US9708370, Hexareline
TypeSmall organic molecule
Emp. Form.C47H58N12O6
Mol. Mass.887.0402
SMILESC[C@H](NC(=O)[C@@H](Cc1c(C)[nH]c2ccccc12)NC(=O)[C@@H](N)Cc1cnc[nH]1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a