Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProto-oncogene tyrosine-protein kinase receptor Ret
LigandBDBM296869
Substrate/Competitorn/a
Meas. Tech.RET Kinase Enzymatic Assay
IC50<10±n/a nM
Citation Demartino, MPGuan, HA Compounds as rearranged during transfection (RET) inhibitors US Patent US10292975 Publication Date 5/21/2019
More Info.:Get all data from this article,  Assay Method
 
Proto-oncogene tyrosine-protein kinase receptor Ret
Name:Proto-oncogene tyrosine-protein kinase receptor Ret
Synonyms:n/a
Type:Protein
Mol. Mass.:53601.71
Organism:Homo sapiens (Human)
Description:n/a
Residue:477
Sequence:
IAAAVLFSFIVSVLLSAFCIHCYHKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSL
DSMENQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAV
KMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLR
ESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAA
RNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSF
GVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPV
FADISKDLEKMMVKRRDYLDLAASTPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWI
ENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM296869
NameBDBM296869
Synonyms:US10111866, Example 2 | US10292975, Example 2
TypeSmall organic molecule
Emp. Form.C26H27F4N3O4
Mol. Mass.521.5039
SMILESCCOc1cc(=O)[nH]cc1-c1ccc(CC(=O)Nc2cc(OCCN(C)C)cc(c2)C(F)(F)F)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a