Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP2 subtype
LigandBDBM263355
Substrate/CompetitorProstaglandin E2 receptor EP4 subtype (EP4)
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Ki 469±n/a nM
Commentsextracted
Citation Donde, YNguyen, JH Compounds and methods for skin repair US Patent US9546162 Publication Date 1/17/2017
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP2 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostanoid EP2 Receptor
Type:Enzyme
Mol. Mass.:39775.71
Organism:Homo sapiens (Human)
Description:P43116
Residue:358
Sequence:
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM263355
NameBDBM263355
Synonyms:US9546162, 13
TypeSmall organic molecule
Emp. Form.C24H25NO4S
Mol. Mass.423.525
SMILESCOc1cc(CO)cc(CN2CCc3cccc(CCc4ccc(s4)C(O)=O)c23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Prostaglandin E2 receptor EP4 subtype (EP4)
Name:Prostaglandin E2 receptor EP4 subtype
Synonyms:PGE receptor EP4 subtype | PGE2 receptor EP4 subtype | PTGER2 | PTGER4 | Prostanoid EP4 receptor
Type:Enzyme
Mol. Mass.:53134.53
Organism:Homo sapiens (Human)
Description:P35408
Residue:488
Sequence:
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: