Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargethIL-1beta
LigandBDBM50070114
Substrate/Competitorn/a
Meas. Tech.cytomteric bead array (CBA) assay
Temperature310.15±n/a K
IC50>10000±n/a nM
Commentsextracted
Citation Gandhi, ADimartino, JChopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017
More Info.:Get all data from this article,  Assay Method
 
hIL-1beta
Name:hIL-1beta
Synonyms:Interleukin 1-beta | Interleukin-1 beta
Type:Cytokine
Mol. Mass.:30734.47
Organism:Homo sapiens (Human)
Description:P01584
Residue:269
Sequence:
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50070114
NameBDBM50070114
Synonyms:(+/-)-thalidomide | 2-(2,6-Dioxo-piperidin-3-yl)-isoindole-1,3-dione | 2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione | CHEMBL468 | K-17 | THALIDOMIDE | Thalomid | [(R,S)-2-(2,6-dioxo-3-piperidinyl)-1H-isoindole-1,3(2H)-dione
TypeSmall organic molecule
Emp. Form.C13H10N2O4
Mol. Mass.258.2295
SMILESO=C1N(C2CCC(=O)NC2=O)C(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a