Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-6
LigandBDBM65454
Substrate/Competitorn/a
Meas. Tech.cytomteric bead array (CBA) assay
Temperature310.15±n/a K
IC50 1200±n/a nM
Commentsextracted
Citation Gandhi, ADimartino, JChopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017
More Info.:Get all data from this article,  Assay Method
 
Interleukin-6
Name:Interleukin-6
Synonyms:B-cell stimulatory factor 2 | BSF-2 | CDF | CTL differentiation factor | Hybridoma growth factor | IFN-beta-2 | IFNB2 | IL-6 | IL6 | Interferon beta-2
Type:n/a
Mol. Mass.:23717.96
Organism:Homo sapiens (Human)
Description:P05231
Residue:212
Sequence:
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65454
NameBDBM65454
Synonyms:191732-72-6 | CC-5013 | Lenalidomide | Revimid | Revlimid | US9694015, 6.1
TypeSmall organic molecule
Emp. Form.C13H13N3O3
Mol. Mass.259.2606
SMILESNc1cccc2C(=O)N(Cc12)C1CCC(=O)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a