Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargethIL-1beta
LigandBDBM65454
Substrate/Competitorn/a
Meas. Tech.cytomteric bead array (CBA) assay
Temperature310.15±n/a K
IC50 390±n/a nM
Commentsextracted
Citation Gandhi, ADimartino, JChopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017
More Info.:Get all data from this article,  Assay Method
 
hIL-1beta
Name:hIL-1beta
Synonyms:Interleukin 1-beta | Interleukin-1 beta
Type:Cytokine
Mol. Mass.:30734.47
Organism:Homo sapiens (Human)
Description:P01584
Residue:269
Sequence:
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM65454
NameBDBM65454
Synonyms:191732-72-6 | CC-5013 | Lenalidomide | Revimid | Revlimid | US9694015, 6.1
TypeSmall organic molecule
Emp. Form.C13H13N3O3
Mol. Mass.259.2606
SMILESNc1cccc2C(=O)N(Cc12)C1CCC(=O)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a