Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase XV
LigandBDBM26980
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
Ki 104000±n/a nM
Citation Innocenti, AHilvo, MParkkila, SScozzafava, ASupuran, CT Carbonic anhydrase inhibitors: the membrane-associated isoform XV is highly inhibited by inorganic anions. Bioorg Med Chem Lett19:1155-8 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase XV
Name:Carbonic Anhydrase XV
Synonyms:CA-XV | Carbonate dehydratase XV
Type:Enzyme
Mol. Mass.:33409.51
Organism:Mus musculus (mouse)
Description:Mouse cloned isozyme.
Residue:306
Sequence:
VDSSGTWCYDSQDPKCGPAHWKELAPACGGPTQSPINIDLRLVQRDYTLKPFIFQGYDSA
PQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEYRLLQLHFHWGSPGHQGSEHSLD
EKHGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLVEEDRDNTNFSAIVSGLKNLSSP
GVAVNLTSTFALASLLPSALRLLRYYRYSGSLTTPGCEPAVLWTVFENTVPIGHAQVVQF
QAVLQTGPPGLHPRPLTSNFRPQQPLGGRRISASPEASVRSSVSTLPCLHLALVGLGVGL
RLWQGP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26980
NameBDBM26980
Synonyms:BROMIDE | Br- | CHEMBL11685 | CHEMBL1644030 | CHEMBL1644694 | bromide | bromide ion
TypeIon
Emp. Form.Br
Mol. Mass.79.905
SMILES[Br-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM10856
NameBDBM10856
Synonyms:Carbon Dioxide | methanedione
TypeSmall organic molecule
Emp. Form.CO2
Mol. Mass.44.0095
SMILESO=C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: