Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin D
LigandBDBM29744
Substrate/CompetitorCathepsin D Peptide Substrate
Meas. Tech.Enzyme Inhibition Measurements
pH3.1±n/a
Temperature295.15±n/a K
IC50 370±n/a nM
Citation Machauer, RVeenstra, SRondeau, JMTintelnot-Blomley, MBetschart, CNeumann, UPaganetti, P Structure-based design and synthesis of macrocyclic peptidomimetic beta-secretase (BACE-1) inhibitors. Bioorg Med Chem Lett19:1361-5 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cathepsin D
Name:Cathepsin D
Synonyms:Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor
Type:Enzyme
Mol. Mass.:44551.72
Organism:Homo sapiens (Human)
Description:Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated.
Residue:412
Sequence:
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29744
NameBDBM29744
Synonyms:hydroxyethylene tripeptide inhibitor, 1
TypeSmall organic molecule
Emp. Form.C25H49N3O4S
Mol. Mass.487.739
SMILESCCCCNC(=O)[C@H](C)C[C@H](O)[C@H](CC(C)C)NC(=O)[C@H](CCSC)NC(=O)CCC(C)C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Cathepsin D Peptide Substrate
Name:Cathepsin D Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2375.29
Organism:n/a
Description:Peptide substrates were obtained from Bachem (Bubendorf, Switzerland).
Residue:20
Sequence:
Mca-GKPILFFRLK(DNP)-D-R-NH2