Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
LigandBDBM263636
Substrate/Competitorn/a
Meas. Tech.Submitochondrial Particle Assay
pH7.4±n/a
IC50<100.0±n/a nM
Commentsextracted
Citation Cesati, RRRadeke, HSPandey, SKPurohit, ARobinson, SP Compositions, methods, and systems for the synthesis and use of imaging agents US Patent US9713651 Publication Date 7/25/2017
More Info.:Get all data from this article,  Assay Method
 
NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Name:NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Synonyms:CI-51kD | Complex I-51kD | NADH dehydrogenase flavoprotein 1 | NADH-ubiquinone oxidoreductase 51 kDa subunit | NDUFV1 | UQOR1
Type:PROTEIN
Mol. Mass.:50659.85
Organism:Bos taurus
Description:EBI_100771
Residue:464
Sequence:
MLAARRLLGGSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRG
DWYKTKEILLKGPDWILGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGHVNNPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALIQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQQFAQQHQARQAAF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM263636
NameBDBM263636
Synonyms:2-(tert-butyl)-4-chloro-5-((4-(2-chloropyrimidin-5-yl)benzyl)oxy)pyridazin-3(2H)-one | US9713651, 48B
TypeSmall organic molecule
Emp. Form.C19H18Cl2N4O2
Mol. Mass.405.278
SMILESCC(C)(C)n1ncc(OCc2ccc(cc2)-c2cnc(Cl)nc2)c(Cl)c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a