BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM30873
Substrate/CompetitorNot Available
Meas. Tech.Dose Response Assay for Agonists of 5-Hydroxytryptamine (Serotonin) Receptor Subtype 1A (5HT1A)
pH7.4±n/a
Temperature296.15±n/a K
EC50 99000±n/a nM
Citation PubChem, PC Dose Response Assay for 5-Hydroxytryptamine (Serotonin) Receptor Subtype 1a (5HT1a) Agonists PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (Human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM30873
NameBDBM30873
Synonyms:2-(4-pyridyl)-5-[[2-(4-pyridyl)-1,3-benzoxazol-5-yl]sulfonyl]-1,3-benzoxazole | 2-pyridin-4-yl-5-[(2-pyridin-4-yl-1,3-benzoxazol-5-yl)sulfonyl]-1,3-benzoxazole | MLS000085540 | SMR000020475 | cid_3241590
TypeSmall organic molecule
Emp. Form.C24H14N4O4S
Mol. Mass.454.457
SMILESO=S(=O)(c1ccc2oc(nc2c1)-c1ccncc1)c1ccc2oc(nc2c1)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Not Available
Name:Not Available
Synonyms:n/a
Type:n/a
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a