BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5-HT1A)
LigandBDBM31043
Substrate/CompetitorNot Available
Meas. Tech.Dose Response Assay for Agonists of 5-Hydroxytryptamine (Serotonin) Receptor Subtype 1A (5HT1A)
pH7.4±n/a
Temperature296.15±n/a K
IC50 3262±n/a nM
Citation PubChem, PC Dose Response Cell Based Assay for Antagonists of the 5-Hydroxytryptamine Receptor Subtype 1A (5HT1A) PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
5-hydroxytryptamine receptor 1A (5-HT1A)
Name:5-hydroxytryptamine receptor 1A (5-HT1A)
Synonyms:5-HT-1A | 5-HT1A | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5-HT-1A) | ADRB2RL1 | ADRBRL1 | Dopamine D2 receptor and serotonin 1a receptor | G-21 | HTR1A | Serotonin receptor 1A
Type:n/a
Mol. Mass.:46122.49
Organism:Homo sapiens (Human)
Description:n/a
Residue:422
Sequence:
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31043
NameBDBM31043
Synonyms:3,6-dioxido-7-(p-tolyl)-4,5-dihydrotriazolo[4,5-e][2,1,3]benzoxadiazole-3,6-diium | 7-(4-methylphenyl)-3,6-bis(oxidanidyl)-4,5-dihydro-[1,2,3]triazolo[4,5-e][2,1,3]benzoxadiazole-3,6-diium | 7-(4-methylphenyl)-3,6-dioxido-4,5-dihydrotriazolo[4,5-e][2,1,3]benzoxadiazole-3,6-diium | 7-p-Tolyl-5,7-dihydro-4H-[1,2,3]triazolo[4',5':3,4]benzo[1,2-c][1,2,5]oxadiazole 3,6-dioxide | MLS000075614 | SMR000010763 | cid_650038
TypeSmall organic molecule
Emp. Form.C13H11N5O3
Mol. Mass.285.2581
SMILESCc1ccc(cc1)-n1nc2-c3n[o+]n([O-])c3CCc2[n+]1[O-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Not Available
Name:Not Available
Synonyms:n/a
Type:n/a
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a