BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPITSLRE serine/threonine-protein kinase CDC2L1
LigandBDBM26474
Substrate/Competitorbiotinylated affinity ligand
Meas. Tech.Kinase Inhibitor Selectivity Profiling Assay
pH7.4±n/a
Temperature298.15±n/a K
Kd 2100±n/a nM
Citation PubChem, PC Kinase Inhibitor Selectivity Profiling Assay PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
PITSLRE serine/threonine-protein kinase CDC2L1
Name:PITSLRE serine/threonine-protein kinase CDC2L1
Synonyms:CDK11 | Cyclin-dependent kinase 11 (CDK11)
Type:Protein
Mol. Mass.:92685.77
Organism:Homo sapiens (Human)
Description:P21127
Residue:795
Sequence:
MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEI
TIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKVHHRKDEKRKEKRRHRSHSAEGGK
HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERK
MREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKVKASHWSRSPPRPPR
ERFELGDGRKPGEARPARAQKPAQLKEEKMEERDLLSDLQDISDSERKTSSAESSSAESG
SGSEEEEEEEEEEEEEGSTSEESEEEEEEEEEEEEETGSNSEEASEQSAEEVSEEEMSED
EERENENHLLVVPESRFDRDSGESEEAEEEVGEGTPQSSALTEGDYVPDSPALSPIELKQ
ELPKYLPALQGCRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPI
TSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVK
TLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVT
LWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDLGTPSEK
IWPGYSELPAVKKMTFSEHPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKH
EYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTT
NQGASAAGPGFSLKF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26474
NameBDBM26474
Synonyms:5-({4-[(2,3-dimethyl-2H-indazol-6-yl)(methyl)amino]pyrimidin-2-yl}amino)-2-methylbenzene-1-sulfonamide | GW-786034 | JMC514632 Compound 13 | PAZOPANIB | Pazopanib | cid_10113978
TypeSmall organic molecule
Emp. Form.C21H23N7O2S
Mol. Mass.437.518
SMILESCN(c1ccc2c(C)n(C)nc2c1)c1ccnc(Nc2ccc(C)c(c2)S(N)(=O)=O)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
biotinylated affinity ligand
Name:biotinylated affinity ligand
Synonyms:n/a
Type:n/a
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a