BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFLT3(D835Y)
LigandBDBM17055
Substrate/Competitorbiotinylated affinity ligand
Meas. Tech.Kinase Inhibitor Selectivity Profiling Assay
pH7.4±n/a
Temperature298.15±n/a K
Kd 130±n/a nM
Citation PubChem, PC Kinase Inhibitor Selectivity Profiling Assay PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
FLT3(D835Y)
Name:FLT3(D835Y)
Synonyms:FL cytokine receptor | Receptor-type tyrosine-protein kinase FLT3 (D835Y) | STK-1 | Stem cell tyrosine kinase 1 | Tyrosine Kinase FLT3 Mutant (D835Y)
Type:n/a
Mol. Mass.:112937.71
Organism:Homo sapiens (Human)
Description:P36888 D835Y
Residue:993
Sequence:
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARYIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17055
NameBDBM17055
Synonyms:(18S)-18-[(dimethylamino)methyl]-17-oxa-4,14,21-triazahexacyclo[19.6.1.1^{7,14}.0^{2,6}.0^{8,13}.0^{22,27}]nonacosa-1(28),2(6),7(29),8(13),9,11,22(27),23,25-nonaene-3,5-dione | (9S)-9-[(dimethylamino)methyl]-6,7,10,11-tetrahydro-9H,18H-5,21:12,17-di(metheno)dibenzo[e,k]pyrrolo[3,4-h][1,4,13]oxadiazacyclohexadecine-18,20(19H)-dione | K00587a | LY 333531 | LY-333531 | LY333531 | Ruboxistaurin | cid_153999
TypeSmall organic molecule
Emp. Form.C28H28N4O3
Mol. Mass.468.5469
SMILESCN(C)C[C@@H]1CCn2cc(C3=C(C(=O)NC3=O)c3cn(CCO1)c1ccccc31)c1ccccc21 |r,t:10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
biotinylated affinity ligand
Name:biotinylated affinity ligand
Synonyms:n/a
Type:n/a
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a