BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM31363
Substrate/CompetitorNot Available
Meas. Tech.Counterscreen assay for S1P3 antagonists: Dose response cell-based high throughput screening assay to identify antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E)
pH7.4±n/a
Temperature296.15±n/a K
IC50 2468±n/a nM
Citation PubChem, PC Counterscreen assay for S1P3 antagonists: Dose response cell-based high throughput screening assay to identify antagonists of the 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E) PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-1E | 5-HT1E | 5-Hydroxytryptamine Receptor Subtype 1E (5HT1E) | 5-hydroxytryptamine receptor 1E | 5-hydroxytryptamine receptor 1E (5-HT-1E) (S31) | 5-hydroxytryptamine receptor 1E (5-HT-1E) (Serotonin receptor 1E) (5-HT1E) (S31). | S31 | Serotonin 1e (5-HT1e) receptor | Serotonin Receptor 1E
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:41697.80
Organism:Homo sapiens (Human)
Description:gi_112822
Residue:365
Sequence:
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31363
NameBDBM31363
Synonyms:MLS000563797 | N-[(R)-[(1R,2R)-2-butylcyclopropyl]-(4-chlorophenyl)methyl]-2-thiophenecarboxamide | N-[(R)-[(1R,2R)-2-butylcyclopropyl]-(4-chlorophenyl)methyl]thiophene-2-carboxamide | SMR000388761 | cid_3247435
TypeSmall organic molecule
Emp. Form.C19H22ClNOS
Mol. Mass.347.902
SMILESCCCC[C@@H]1C[C@H]1[C@@H](NC(=O)c1cccs1)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Not Available
Name:Not Available
Synonyms:n/a
Type:n/a
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a