Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBiotin Carboxylase
LigandBDBM32641
Substrate/CompetitorBiotinyl-BCCP
Meas. Tech.ACCase-Coupled Enzyme Assay
pH8±n/a
Temperature296.15±n/a K
IC50 125±n/a nM
Citation Mochalkin, IMiller, JRNarasimhan, LThanabal, VErdman, PCox, PBPrasad, JVLightle, SHuband, MDStover, CK Discovery of antibacterial biotin carboxylase inhibitors by virtual screening and fragment-based approaches. ACS Chem Biol4:473-83 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Biotin Carboxylase
Name:Biotin Carboxylase
Synonyms:ACC | Acetyl-CoA carboxylase subunit A
Type:A component of the acetyl coenzyme A carboxylase complex
Mol. Mass.:49324.23
Organism:Escherichia coli (strain K12)
Description:The accC gene was amplified by PCR from E. coli genomic DNA. The recombinant protein was expressed and purified from E. coli.
Residue:449
Sequence:
MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSY
LNIPAIISAAEITGAVAIHPGYGFLSENANFAEQVERSGFIFIGPKAETIRLMGDKVSAI
AAMKKAGVPCVPGSDGPLGDDMDKNRAIAKRIGYPVIIKASGGGGGRGMRVVRGDAELAQ
SISMTRAEAKAAFSNDMVYMEKYLENPRHVEIQVLADGQGNAIYLAERDCSMQRRHQKVV
EEAPAPGITPELRRYIGERCAKACVDIGYRGAGTFEFLFENGEFYFIEMNTRIQVEHPVT
EMITGVDLIKEQLRIAAGQPLSIKQEEVHVRGHAVECRINAEDPNTFLPSPGKITRFHAP
GGFGVRWESHIYAGYTVPPYYDSMIGKLICYGENRDVAIARMKNALQELIIDGIKTNVDL
QIRIMNDENFQHGGTNIHYLEKKLGLQEK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32641
NameBDBM32641
Synonyms:amino-oxazole, 2c
TypeSmall organic molecule
Emp. Form.C18H17N3O2
Mol. Mass.307.3465
SMILESNc1ncc(o1)C(=O)N(Cc1ccccc1)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Biotinyl-BCCP
Name:Biotinyl-BCCP
Synonyms:AccB | Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Type:biotin binding protein
Mol. Mass.:16678.47
Organism:Escherichia coli (strain K12)
Description:n/a
Residue:156
Sequence:
MDIRKIKKLIELVEESGISELEISEGEESVRISRAAPAASFPVMQQAYAAPMMQQPAQSN
AAAPATVPSMEAPAAAEISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEA
MKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: