Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase JAK2 [828-1132]
LigandBDBM400520
Substrate/Competitorn/a
Meas. Tech.In Vitro JAK Kinase Assay
IC50<5±n/a nM
Citation Huang, TXue, C Piperidin-4-yl azetidine derivatives as JAK1 inhibitors US Patent US9999619 Publication Date 6/19/2018
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase JAK2 [828-1132]
Name:Tyrosine-protein kinase JAK2 [828-1132]
Synonyms:JAK2 (aa 828-1132) | Tyrosine-protein kinase JAK2
Type:n/a
Mol. Mass.:35579.28
Organism:Homo sapiens (Human)
Description:O60674[828-1132]
Residue:305
Sequence:
GALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHS
TEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKER
IDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEY
YKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGN
DKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIR
DNMAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM400520
NameBDBM400520
Synonyms:US10695337, Example 276 | US11285140, Example 276 | US9999619, Example 276
TypeSmall organic molecule
Emp. Form.C27H25F2N7O
Mol. Mass.501.5305
SMILESFc1cccc(C(=O)N2CCC(CC2)N2CC(CC#N)(C2)n2ccc(c2)-c2ncnc3[nH]ccc23)c1F
Structure
n/a