BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMPI protein
LigandBDBM34572
Substrate/CompetitorMannose-6-phosphate
Meas. Tech.HTS identification of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay using a high concentration of mannose 6-phosphate
pH7.4±n/a
Temperature296.15±n/a K
IC50>50000±0 nM
Citation PubChem, PC HTS identification of compounds inhibiting phosphomannose isomerase (PMI) via a fluorescence intensity assay using a high concentration of mannose 6-phosphate PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MPI protein
Name:Mannose-6-phosphate isomerase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:46651.35
Organism:Homo sapiens (Human)
Description:ChEMBL_1448919
Residue:423
Sequence:
MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAK
ILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEK
LHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLK
QTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQ
LHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTP
KFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYK
VLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRAC
CLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM34572
NameBDBM34572
Synonyms:BRIMONIDINE | CHEMBL844 | MLS000069370 | SMR000058355 | UK 14,304 | cid_2435
TypeSmall organic molecule
Emp. Form.C11H10BrN5
Mol. Mass.292.135
SMILESBrc1c(NC2=NCCN2)ccc2nccnc12 |t:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Mannose-6-phosphate
Name:Mannose-6-phosphate
Synonyms:n/a
Type:n/a
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a