Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetkinesin spindle protein Mutant (D130V)
LigandBDBM36351
Substrate/Competitorn/a
Meas. Tech.HCT116-D130V IC50 biaryl selected
pH6.8±0
IC50 0.20±0.0 nM
Citation Luo, LParrish, CANevins, NMcNulty, DEChaudhari, AMCarson, JDSudakin, VShaw, ANLehr, RZhao, HSweitzer, SLad, LWood, KWSakowicz, RAnnan, RSHuang, PSJackson, JRDhanak, DCopeland, RAAuger, KR ATP-competitive inhibitors of the mitotic kinesin KSP that function via an allosteric mechanism. Nat Chem Biol3:722-6 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
kinesin spindle protein Mutant (D130V)
Name:kinesin spindle protein Mutant (D130V)
Synonyms:KSP Mutant (D130V)
Type:PROTEIN
Mol. Mass.:119124.02
Organism:Homo sapiens (Human)
Description:Kinesin-like spindle protein HKSP
Residue:1056
Sequence:
MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEVPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY
ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS
LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV
SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT
SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ
ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS
QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE
TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM
MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK
DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36351
NameBDBM36351
Synonyms:CID148124 | Docetaxel
TypeSmall organic molecule
Emp. Form.C43H53NO14
Mol. Mass.807.8792
SMILES[H][C@]12[C@H](OC(=O)c3ccccc3)[C@]3(O)C[C@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)c4ccccc4)C(C)=C([C@@H](O)C(=O)[C@]1(C)[C@@H](O)C[C@H]1OC[C@@]21OC(C)=O)C3(C)C |t:39|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a