Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReceptor-interacting protein 1 (RIPK1)
LigandBDBM36372
Substrate/Competitorn/a
Meas. Tech.RIP1 Kinase Assay
pH7.3±0
Temperature303.15±0 K
EC50 18±0.0 nM
Citation Degterev, AHitomi, JGermscheid, MCh'en, ILKorkina, OTeng, XAbbott, DCuny, GDYuan, CWagner, GHedrick, SMGerber, SALugovskoy, AYuan, J Identification of RIP1 kinase as a specific cellular target of necrostatins. Nat Chem Biol4:313-21 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Receptor-interacting protein 1 (RIPK1)
Name:Mitogen-activated protein kinase 10/Receptor-interacting serine/threonine-protein kinase 1
Synonyms:Mitogen-activated protein kinase 10/Receptor-interacting serine/threonine-protein kinase 1 | RIP-1 | RIPK1 | Receptor-interacting protein 1 | Receptor-interacting serine/threonine-protein kinase 1
Type:Enzyme Catalytic Domain
Mol. Mass.:75926.99
Organism:Homo sapiens (Human)
Description:aa 8-327
Residue:671
Sequence:
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36372
NameBDBM36372
Synonyms:(5R)-5-[(7-chloro-1H-indol-3-yl)methyl]-3-methyl-2,4-Imidazolidinedione, 11 | CID11288934
TypeSmall oganic molecule
Emp. Form.C13H12ClN3O2
Mol. Mass.277.706
SMILESCN1C(=O)N[C@H](Cc2c[nH]c3c(Cl)cccc23)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a