Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstrogen receptor alpha Y537S
LigandBDBM263664
Substrate/Competitorn/a
Meas. Tech.Estrogen Receptor Coactivator Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 22.0±n/a nM
Commentsextracted
Citation Bouaboula, MBrollo, MCertal, VEl-Ahmad, YFiloche-Romme, BHalley, FMcCort, GSchio, LTabart, MTerrier, CThompson, F Substituted 6,7-dihydro-5H-benzo[7]annulene compounds, processes for their preparation and therapeutic uses thereof US Patent US9714221 Publication Date 7/25/2017
More Info.:Get all data from this article,  Assay Method
 
Estrogen receptor alpha Y537S
Name:Estrogen receptor alpha Y537S
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:66154.35
Organism:Homo sapiens (Human)
Description:n/a
Residue:595
Sequence:
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM263664
NameBDBM263664
Synonyms:US9714221, Example 1
TypeSmall organic molecule
Emp. Form.C30H32FNO3
Mol. Mass.473.5784
SMILESOc1ccc(cc1)C1=C(c2ccc(O[C@H]3CCN(CCCF)C3)cc2)c2cc(O)ccc2CCC1 |r,c:8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a