Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstrogen receptor alpha D538G
LigandBDBM263681
Substrate/Competitorn/a
Meas. Tech.Estrogen Receptor Coactivator Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 28.0±n/a nM
Commentsextracted
Citation Bouaboula, MBrollo, MCertal, VEl-Ahmad, YFiloche-Romme, BHalley, FMcCort, GSchio, LTabart, MTerrier, CThompson, F Substituted 6,7-dihydro-5H-benzo[7]annulene compounds, processes for their preparation and therapeutic uses thereof US Patent US9714221 Publication Date 7/25/2017
More Info.:Get all data from this article,  Assay Method
 
Estrogen receptor alpha D538G
Name:Estrogen receptor alpha D538G
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:66173.42
Organism:Homo sapiens (Human)
Description:n/a
Residue:595
Sequence:
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYGLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM263681
NameBDBM263681
Synonyms:6-(2,4- dichloro- phenyl)-5-[4- [(3S)-1-(3- fluoropropyl)- pyrrolidin-3- yl]oxy- phenyl]-8,9- dihydro- 7H- benzo[7]- annulen-2-ol | US9714221, Example 18
TypeSmall organic molecule
Emp. Form.C30H30Cl2FNO2
Mol. Mass.526.469
SMILESOc1ccc2c(CCCC(c3ccc(Cl)cc3Cl)=C2c2ccc(O[C@H]3CCN(CCCF)C3)cc2)c1 |r,c:18|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a