Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMethylthioadenosine Nucleosidase (MTAN)
LigandBDBM36495
Substrate/CompetitorBDBM22111
Meas. Tech.Enzyme Activity Assay
pH7.5±0
Temperature298.15±0 K
Kd 12±0.0 nM
Citation Gutierrez, JALuo, MSingh, VLi, LBrown, RLNorris, GEEvans, GBFurneaux, RHTyler, PCPainter, GFLenz, DHSchramm, VL Picomolar inhibitors as transition-state probes of 5'-methylthioadenosine nucleosidases. ACS Chem Biol2:725-34 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Methylthioadenosine Nucleosidase (MTAN)
Name:Methylthioadenosine Nucleosidase (MTAN)
Synonyms:5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase | mtnN
Type:Enzyme
Mol. Mass.:24526.81
Organism:Staphylococcus aureus
Description:Q5HFG2
Residue:228
Sequence:
MIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTL
LINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQS
SKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQT
CYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36495
BDBM22111
NameBDBM36495
Synonyms:CHEMBL554642 | ImmA-Bn
TypeSmall organic moelcule
Emp. Form.C18H21N5O2S
Mol. Mass.371.457
SMILESNc1ncnc2c(c[nH]c12)C1NC(CSCc2ccccc2)C(O)C1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: