Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 protease
LigandBDBM518
Substrate/Competitorn/a
Meas. Tech.Protease Inhibtion Assay
pH5.5±0
Ki 0.530±0.18 nM
Citation Rodgers, JDLam, PYJohnson, BLWang, HLi, RRu, YKo, SSSeitz, SPTrainor, GLAnderson, PSKlabe, RMBacheler, LTCordova, BGarber, SReid, CWright, MRChang, CHErickson-Viitanen, S Design and selection of DMP 850 and DMP 851: the next generation of cyclic urea HIV protease inhibitors. Chem Biol5:597-608 (1998) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 protease
Name:HIV-1 protease
Synonyms:HIV-1 protease wild type
Type:Protein
Mol. Mass.:10757.68
Organism:Human immunodeficiency virus
Description:O90785
Residue:99
Sequence:
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
QVLIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM518
NameBDBM518
Synonyms:(3S,4aS,8aS)-N-tert-butyl-2-[(2R,3R)-2-hydroxy-3-[(3-hydroxy-2-methylphenyl)formamido]-4-(phenylsulfanyl)butyl]-decahydroisoquinoline-3-carboxamide | AG-1343 | CHEMBL584 | Nelfinavir | Viracept
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a