Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetJAK1 (866-1154)
LigandBDBM264192
Substrate/Competitorn/a
Meas. Tech.JAK Enzymatic Assay
pH7.3±n/a
IC50 166±n/a nM
Commentsextracted
Citation Grimster, NKawatkar, SKettle, JGSu, QVasbinder, MChuaqui, CE Compounds and methods for inhibiting JAK US Patent US9714236 Publication Date 7/25/2017
More Info.:Get all data from this article,  Assay Method
 
JAK1 (866-1154)
Name:JAK1 (866-1154)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:34254.95
Organism:Homo sapiens (human)
Description:n/a
Residue:299
Sequence:
VSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESG
GNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKI
NLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYY
TVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPT
HGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM264192
NameBDBM264192
Synonyms:(2R)-2-[(3R)-3,4- dimethylpiperazin-1- yl]-N-(3-{2-[(3-ethoxy- 1-methyl-1H- pyrazol-4-yl)amino]-5- fluoropyrimidin-4-yl}- 1H-indol-7-yl)propanamide | US10167276, Example 13 | US9714236, 13
TypeSmall organic molecule
Emp. Form.C27H34FN9O2
Mol. Mass.535.6164
SMILESCCOc1nn(C)cc1Nc1ncc(F)c(n1)-c1c[nH]c2c(NC(=O)[C@@H](C)N3CCN(C)[C@H](C)C3)cccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a