Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetJAK2 (831-1132)
LigandBDBM264196
Substrate/Competitorn/a
Meas. Tech.JAK Enzymatic Assay
pH7.3±n/a
IC50 18100±n/a nM
Commentsextracted
Citation Grimster, NKawatkar, SKettle, JGSu, QVasbinder, MChuaqui, CE Compounds and methods for inhibiting JAK US Patent US9714236 Publication Date 7/25/2017
More Info.:Get all data from this article,  Assay Method
 
JAK2 (831-1132)
Name:JAK2 (831-1132)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:35337.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:302
Sequence:
GFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEE
HLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDH
IKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKV
KEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQ
GQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
AG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM264196
NameBDBM264196
Synonyms:(2R)-2-[4-(2- methoxyethyl)piperazin- 1-yl]-N-(3-{2-[(3- methoxy-1-methyl-1H- pyrazol-4-yl)amino]-5- methylpyrimidin-4- yl}-1H-indol-7- yl)propanamide | US10167276, Example 17 | US9714236, 17
TypeSmall organic molecule
Emp. Form.C28H37N9O3
Mol. Mass.547.6519
SMILESCOCCN1CCN(CC1)[C@H](C)C(=O)Nc1cccc2c(c[nH]c12)-c1nc(Nc2cn(C)nc2OC)ncc1C |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a