Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetJAK2 (831-1132)
LigandBDBM264236
Substrate/Competitorn/a
Meas. Tech.JAK Enzymatic Assay
pH7.3±n/a
IC50 5150±n/a nM
Commentsextracted
Citation Grimster, NKawatkar, SKettle, JGSu, QVasbinder, MChuaqui, CE Compounds and methods for inhibiting JAK US Patent US9714236 Publication Date 7/25/2017
More Info.:Get all data from this article,  Assay Method
 
JAK2 (831-1132)
Name:JAK2 (831-1132)
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:35337.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:302
Sequence:
GFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEE
HLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDH
IKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKV
KEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQ
GQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
AG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM264236
NameBDBM264236
Synonyms:(2R)-N-(3-{2-[(1,3- dimethyl-1H-pyrazol- 4-yl)amino]-5- fluoropyrimidin-4-yl}- 1H-indol-7-yl)-2- (4-methylpiperazin-1- yl)propanamide | US10167276, Example 56 | US9714236, 56
TypeSmall organic molecule
Emp. Form.C25H30FN9O
Mol. Mass.491.5638
SMILESC[C@@H](N1CCN(C)CC1)C(=O)Nc1cccc2c(c[nH]c12)-c1nc(Nc2cn(C)nc2C)ncc1F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a