Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-RAF (Y340D Y341D)
LigandBDBM50396483
Substrate/Competitorn/a
Meas. Tech.RAF Kinase Activity
IC50 128±n/a nM
Citation Bae, IHSon, JBHan, SMKwak, EJKim, HSSong, JYByun, EYJun, SAAhn, YGSuh, KH Thieno[3,2-D]pyrimidine derivatives having inhibitory activity for protein kinases US Patent US Patent
More Info.:Get all data from this article,  Assay Method
 
C-RAF (Y340D Y341D)
Name:C-RAF (Y340D Y341D)
Synonyms:RAF proto-oncogene serine/threonine-protein kinase (Y340D/Y341D) | RAF proto-oncogene serine/threonine-protein kinase (c-Raf)(Y340D)(Y341D)
Type:Serine/threonine-protein kinase
Mol. Mass.:72984.33
Organism:Homo sapiens (Human)
Description:P04049 Y340D Y341D
Residue:648
Sequence:
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSDDWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50396483
NameBDBM50396483
Synonyms:PLX-4032 | RG 7204 | Ro 5185426 | US9388165, Reference, Vemurafenib (PLX-4032) | USRE47451, PLX-4032, Roche | VEMURAFENIB
TypeSmall organic molecule
Emp. Form.C23H18ClF2N3O3S
Mol. Mass.489.922
SMILESCCCS(=O)(=O)Nc1ccc(F)c(C(=O)c2c[nH]c3ncc(cc23)-c2ccc(Cl)cc2)c1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a