BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMKP-3
LigandBDBM32062
Substrate/Competitorn/a
Meas. Tech.In vitro MKP-3 Phosphatase Dose Response Hit/Probe Assessment Assay
IC50>50000±n/a nM
Citation PubChem, PC In vitro MKP-3 Phosphatase Dose Response Hit/Probe Assessment Assay PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
MKP-3
Name:MKP-3
Synonyms:MAP kinase phosphatase 3 | Mitogen-activated protein kinase phosphatase 3
Type:Enzyme
Mol. Mass.:42303.19
Organism:Rattus norvegicus
Description:gi_16758752
Residue:381
Sequence:
MIDTLRPVPFASEMAISKTVAWLNEQLELGNEQLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRCEDRDRFTRRCGTDTVVLYDENSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ
QLYFTAPSNQNVYQVDSLQST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32062
NameBDBM32062
Synonyms:MLS000054842 | N-(1-butyl-3-cyano-2-pyrrolo[3,2-b]quinoxalinyl)benzamide | N-(1-butyl-3-cyano-pyrrolo[3,2-b]quinoxalin-2-yl)benzamide | N-(1-butyl-3-cyanopyrrolo[3,2-b]quinoxalin-2-yl)benzamide | SMR000060333 | US9045483, 3 | US9073941, 1003 | cid_1910302
TypeSmall organic molecule
Emp. Form.C22H19N5O
Mol. Mass.369.4192
SMILESCCCCn1c(NC(=O)c2ccccc2)c(C#N)c2nc3ccccc3nc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a