BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSteroidogenic Factor 1
LigandBDBM31058
Substrate/Competitorn/a
Meas. Tech.Counterscreen for inhibitors of the Retinoic Acid Receptor-related orphan receptor A (RORA): A cell-based dose-response assay for inhibition of the Steroidogenic Factor 1 (SF-1)
IC50 390±n/a nM
Citation PubChem, PC Counterscreen for inhibitors of the Retinoic Acid Receptor-related orphan receptor A (RORA): A cell-based dose-response assay for inhibition of the Steroidogenic Factor 1 (SF-1) PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Steroidogenic Factor 1
Name:Steroidogenic Factor 1
Synonyms:Adrenal 4-binding protein | Fushi tarazu factor homolog 1 | Nuclear receptor subfamily 5 group A member 1 | SF-1 | STF-1 | Steroid hormone receptor Ad4BP
Type:Nuclear Hormone Receptor
Mol. Mass.:51643.43
Organism:Homo sapiens (Human)
Description:n/a
Residue:461
Sequence:
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPL
AGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV
RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLA
LQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31058
NameBDBM31058
Synonyms:3-(2-methoxyphenyl)-6-p-phenetyl-7H-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazine | 6-(4-ethoxyphenyl)-3-(2-methoxyphenyl)-7H-[1,2,4]triazolo[3,4-b][1,3,4]thiadiazine | MLS000081448 | SMR000043931 | cid_663143
TypeSmall organic molecule
Emp. Form.C19H18N4O2S
Mol. Mass.366.437
SMILESCCOc1ccc(cc1)C1=Nn2c(SC1)nnc2-c1ccccc1OC |t:10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a