BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 3
LigandBDBM31078
Substrate/Competitorn/a
Meas. Tech.S1P3 Dose Response Assay Counterscreen for 5-Hydroxytryptamine(Serotonin) Receptor Subtype 1E Antagonists
IC50>50000±n/a nM
Citation PubChem, PC S1P3 Dose Response Assay Counterscreen for 5-Hydroxytryptamine(Serotonin) Receptor Subtype 1E Antagonists PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Sphingosine 1-phosphate receptor 3
Name:Sphingosine 1-phosphate receptor 3
Synonyms:EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42278.13
Organism:Homo sapiens (Human)
Description:Q99500
Residue:378
Sequence:
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31078
NameBDBM31078
Synonyms:2-(4-fluorophenyl)-3-(4-methoxyphenyl)-5,6,7,7a-tetrahydro-3H-pyrrol[1,2-c]imidazol-1-one | 2-(4-fluorophenyl)-3-(4-methoxyphenyl)-5,6,7,7a-tetrahydro-3H-pyrrolo[1,2-c]imidazol-1-one | MLS000117211 | SMR000094164 | cid_5308770
TypeSmall organic molecule
Emp. Form.C19H19FN2O2
Mol. Mass.326.3648
SMILESCOc1ccc(cc1)C1N2CCCC2C(=O)N1c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a