BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM33066
Substrate/Competitorn/a
Meas. Tech.Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2
EC50 210±n/a nM
Citation PubChem, PC Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2 PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM33066
NameBDBM33066
Synonyms:2,5-bis(chloranyl)-3-[2-(dimethylamino)-1,3-thiazol-5-yl]-6-pyrrolidin-1-yl-cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-[2-(dimethylamino)-1,3-thiazol-5-yl]-6-(1-pyrrolidinyl)benzo-1,4-quinone | 2,5-dichloro-3-[2-(dimethylamino)-1,3-thiazol-5-yl]-6-pyrrolidin-1-ylcyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-[2-(dimethylamino)-5-thiazolyl]-6-(1-pyrrolidinyl)cyclohexa-2,5-diene-1,4-dione | 2,5-dichloro-3-[2-(dimethylamino)thiazol-5-yl]-6-pyrrolidino-p-benzoquinone | MLS000548208 | SMR000115102 | cid_1002248
TypeSmall organic molecule
Emp. Form.C15H15Cl2N3O2S
Mol. Mass.372.27
SMILESCN(C)c1ncc(s1)C1=C(Cl)C(=O)C(N2CCCC2)=C(Cl)C1=O |c:9,t:20|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a