BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM33102
Substrate/Competitorn/a
Meas. Tech.Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2
EC50 980±n/a nM
Citation PubChem, PC Multiplexed high-throughput screen for small molecule regulators of Bcl-2 family protein interactions, specifically Bim-Bcl-2 PubChem Bioassay(2008)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM33102
NameBDBM33102
Synonyms:MLS000571745 | N-ethyl-N-(1-hydroxy-3,4-diketo-2-naphthyl)propionamide | N-ethyl-N-(1-hydroxy-3,4-dioxo-2-naphthalenyl)propanamide | N-ethyl-N-(1-hydroxy-3,4-dioxonaphthalen-2-yl)propanamide | N-ethyl-N-(3-hydroxy-1,4-dioxo-1,4-dihydro-2-naphthalenyl)propanamide | N-ethyl-N-[1-oxidanyl-3,4-bis(oxidanylidene)naphthalen-2-yl]propanamide | SMR000193757 | cid_2879069
TypeSmall organic molecule
Emp. Form.C15H15NO4
Mol. Mass.273.2839
SMILESCCN(C1C(=O)C(=O)c2ccccc2C1=O)C(=O)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a