BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDopamine D5 receptor
LigandBDBM36952
Substrate/Competitorn/a
Meas. Tech.Allosteric Modulators of D1 Receptors: Dose-dependent Counterscreen
EC50 0.00532±n/a nM
Citation PubChem, PC Allosteric Modulators of D1 Receptors: Dose-dependent Counterscreen PubChem Bioassay(2007)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Dopamine D5 receptor
Name:Dopamine receptor
Synonyms:D(1B) dopamine receptor | D(5) dopamine receptor | D1beta dopamine receptor | DOPAMINE D5 | DRD5 | Dopamine receptor | dopamine receptor D5
Type:Protein
Mol. Mass.:52943.41
Organism:Homo sapiens (Human)
Description:P21918
Residue:477
Sequence:
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM36952
NameBDBM36952
Synonyms:3-(4-ethoxy-3-methoxy-phenyl)-5-(3-pyridyl)-1,2,4-oxadiazole | 3-(4-ethoxy-3-methoxy-phenyl)-5-pyridin-3-yl-1,2,4-oxadiazole | 3-(4-ethoxy-3-methoxyphenyl)-5-(3-pyridinyl)-1,2,4-oxadiazole | 3-(4-ethoxy-3-methoxyphenyl)-5-pyridin-3-yl-1,2,4-oxadiazole | MLS000083724 | SMR000047398 | cid_666153
TypeSmall organic molecule
Emp. Form.C16H15N3O3
Mol. Mass.297.3086
SMILESCCOc1ccc(cc1OC)-c1noc(n1)-c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a