BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targettransient receptor potential cation channel, subfamily N, member 1
LigandBDBM46942
Substrate/Competitorn/a
Meas. Tech.Fluorescence counterscreen assay for TRPML3 agonists: dose response cell-based high-throughput screening assay to identify agonists of the transient receptor potential channel N1 (TRPN1)
EC50 29900±n/a nM
Citation PubChem, PC Fluorescence counterscreen assay for TRPML3 agonists: dose response cell-based high-throughput screening assay to identify agonists of the transient receptor potential channel N1 (TRPN1) PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
transient receptor potential cation channel, subfamily N, member 1
Name:transient receptor potential cation channel, subfamily N, member 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:175824.78
Organism:Danio rerio
Description:Q7T1G6
Residue:1614
Sequence:
MSESSCVSGAPQRLVPLALRGEWMALEQKIKTLERGDPDILQCDEESGMSLLMLAVRESR
LSVLDRLLELGANPSDKTKDGRSALHIAAAHSKDEIVKLLVRKTDPNSPAGPNDQLPLHY
AASRSTGGLAVVQTLLKFSSKDARLTPDKNGCLPLLLAAEAGNVGIVRELLSSQSEPQIR
AAKTANGDTALHICCRRRDVEMAKILVEFGANPDSQNDEGQTPLHIAAHEGDENMLKFLY
LCKANANISDKMDRSPLHIAAERGHTNVVEILTEKFRSCVLARTKDGNTLLHIASQCGHP
TTALSFLRKGVPLHMPNKSGAVCLHAAAKRGHTAVVKALLQKGAHVDAAARDGQTALHIA
VENCRPQVVQMLLGFGAHVQLRGGKAQETPLHISARVKEGERAAEMLLKSGAEVNAEQEN
GETALHVAARHGSLQMIRALIQEGGDPRWRSRVGESPLHVAVRHCHAHVVQEILTFLTNE
KSRRDAELCVCEGNQDGETALHLAAELRTDALHQPEEDITIIQILMEHQADITAVTRQTG
ETPLHYSARVGNTAVLQEMLRNVPTNQIQTAINKHSKNGWSPLLLAADQGHTEVVKILLQ
NNARVDVFDEEGKAAIHLAAQRGHQDIVDVLLSQKAFVNAKTKQGLTPLHLSAQNGSARL
VRLLVENHQASVDALSLRKQTPLHLAAMSGQLDVCSSLLNLRADITATDSRGQTPLHLAA
ESDHSEVVKLFLRLRPELSTLANEDGSTCTHIAAAKGSVSVIRELLMFNQGGVGTLNHKA
HGLCPLHLAAAGGHAEVVKVLLEAGASVTEEDAEGMTAVHLAAKHGHTHILEVLRGSVPL
KIQSSKTGFTALHVAASFGQMNFVREILTKVPATIRSEFPTISGKDDIKRQQPLAESGFT
PLHLASQSGHESVVRLLLNCPGVQADAETNIQGSSPLHLAAQSGHTAVVGLLLSRSSSLL
HQADRRGRSALHLAAAHGHVDMVRVLLGQGAEINHTDMSGWTALHYAAEAGCLEVLLFLV
ESGASACAECHGGRTPLQYAAQQNHESAVIFLLRREKNTLRLLDDKKFIFNLMVCGRMND
NLSLEELVLHTSAPLDTAVRLSRALTLCALREKERSVDLQAAAHHCELMASDLLSLSASA
GGQGAGAGPILRALDHRGLSVLDCLIEGRQKGVVSQPAVQTYLTEVWCGGLQWDSWKILL
LFCCLLLCPPLWLLLALPLTHSFNTIPIVKFMSHLVSHIFLLTLFILTIVYPPVSPLSQA
RLMPSWSECLLLIWLCGMLVSELTFPGERTGLAWIRLLLLGFSAAALLCHLLAVFTQWWP
PTHLHCLFARNVLLAVAMTLGFIQLLEFLTFHHLFGPWAIIIRDLIKDLCRFAVILMLFH
TAFTLSLTALCQPLYPQEQHNTTTEVTVPGPLNMSVLLFFALFGLTEPDKIPDVDRSPPA
TAVLAKMVFGVYLVVTFIVLINLLIAMMSDTYQRIQAQSDTEWKFGRAVLIRDMSRKSGI
PSPFNLFTNLFYSVKVVCKRAGKMCSSESRDVMNEDEDAEGLSESRSLDLLSQASVSGIR
GNKRTQILPEGGQISLAHSGGHVRVENVADWPSVVQQFLSQRRQRDRSTAERDE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM46942
NameBDBM46942
Synonyms:1-(4-ethoxy-2,3-dimethyl-phenyl)sulfonylpiperidine | 1-(4-ethoxy-2,3-dimethylphenyl)sulfonylpiperidine | 1-[(4-ethoxy-2,3-dimethylphenyl)sulfonyl]piperidine | MLS000693818 | SMR000299866 | cid_976573
TypeSmall organic molecule
Emp. Form.C15H23NO3S
Mol. Mass.297.413
SMILESCCOc1ccc(c(C)c1C)S(=O)(=O)N1CCCCC1
Structure
n/a