Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransient receptor potential M8 protein (TRPM8)
LigandBDBM241597
Substrate/Competitorn/a
Meas. Tech.Canine TRPM8 Functional Assay
Temperature298.15±n/a K
IC50 16.0±n/a nM
Commentsextracted
Citation Player, MRCalvo, RChen, JMeegalla, SParks, DJParsons, WJBallentine, SBranum, S Substituted aza-bicyclic imidazole derivatives useful TRPM8 receptor modulators US Patent US9718820 Publication Date 8/1/2017
More Info.:Get all data from this article,  Assay Method
 
Transient receptor potential M8 protein (TRPM8)
Name:Transient receptor potential M8 protein (TRPM8)
Synonyms:Cold-menthol receptor (TRPM8) | TRPM8 Receptor | Transient receptor potential M8 protein | Transient receptor potential melastatin subfamily, type 8 (TRPM8)
Type:Enzyme
Mol. Mass.:127589.43
Organism:Canis lupus familiaris (Dog)
Description:Q1A7N1
Residue:1104
Sequence:
MSFEGARLSMRNRRNGTLDSTRTLYSSTSRSTDVSYSESDLVNFIQANFKKRECVFFTKD
SKATENVCKCGYAQSQHIEGTQINSNEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRL
SCDTDAETLYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
TGGTHYGLMKYIGEVVRDNTISRNSEENIVAIGIAAWGMVSNRDTLLRNCDAEGYFSAQY
IMDDFKRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
IVCFAQGGGRETLKAINTSIKSKIPCVVVEGSGQIADVIASLVEVEDVLTSSVVKEKLVR
FLPRTVSRLPEEETESWIKWLKEILESSHLLTVIKMEEAGDEIVSNAISYALYKAFSTNE
QDKDNWNGQLKLLLEWNQLDLANEEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
GLNLRKFLTNDVLTELFSNHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRGFRKEDR
SSRDDIDVELHDVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELA
VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGFVSFRKKPIDKH
KKILWYYVAFFTSPFVVFAWNVVFYIAFLLLFAYVLLMDFHSVPHSPELVLYALVFVLFC
DEVRQWYMNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHPSNKTSLYSGRVIFCLDYIIFT
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEHRWRWIF
RSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
CIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCNRLNIPFPFVVFAY
FYMVVKKCFGCCCREKHAEPSACCFRNEDNETLAWEGVMKENYLVKINTKANDTSQEMRH
RFRQLDTKINDLKGLLKEIANKIK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM241597
NameBDBM241597
Synonyms:US9409915, 5 | US9718820, Compound 5
TypeSmall organic molecule
Emp. Form.C21H17Cl2F3N5Na
Mol. Mass.490.284
SMILESCn1nc(c(Cl)c1-c1nc2nc(cc(Cl)c2n1[Na])-c1ccccc1C(F)(F)F)C(C)(C)C |(-4.07,-3.68,;-4.54,-2.22,;-6.01,-1.74,;-6.01,-.2,;-4.54,.27,;-4.07,1.74,;-3.64,-.97,;-2.1,-.97,;-1.19,.27,;.27,-.2,;1.61,.57,;2.94,-.2,;2.94,-1.74,;1.61,-2.51,;1.61,-4.05,;.27,-1.74,;-1.19,-2.22,;-1.67,-3.68,;4.27,.57,;5.61,-.2,;6.94,.57,;6.94,2.11,;5.61,2.88,;4.27,2.11,;2.94,2.88,;1.61,3.65,;3.71,4.21,;2.17,1.54,;-7.25,.7,;-8.5,1.61,;-6.35,1.95,;-8.16,-.54,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a