BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRas-related protein Rab-2A.
LigandBDBM22360
Substrate/Competitorn/a
Meas. Tech.Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab2 wildtype
EC50 30000±n/a nM
Citation PubChem, PC Additional SAR compounds tested via Multiplex dose response to identify specific small molecule inhibitors of Ras and Ras-related GTPases specifically Rab2 wildtype PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Ras-related protein Rab-2A.
Name:Ras-related protein Rab-2A.
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:23545.28
Organism:Canis lupus familiaris
Description:gi_46577642
Residue:212
Sequence:
MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNATHAGNQGGQQAGGGCC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22360
NameBDBM22360
Synonyms:2-(acetyloxy)benzoate | 2-(acetyloxy)benzoic acid | Acetylsalicylic acid | Aspirin | Endosprin | Polopirin | Zorprin | acetylsalicylate | cid_2244
TypeAnti-Inflammatory Agents, Non-Steroidal
Emp. Form.C9H8O4
Mol. Mass.180.1574
SMILESCC(=O)Oc1ccccc1C(O)=O
Structure
n/a