BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetnucleotide-binding oligomerization domain containing 1
LigandBDBM237
Substrate/Competitorn/a
Meas. Tech.uHTS luminescence assay for the identification of compounds that inhibit NOD1
EC50 17300±n/a nM
Citation PubChem, PC uHTS luminescence assay for the identification of compounds that inhibit NOD1 PubChem Bioassay(2010)[AID]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
nucleotide-binding oligomerization domain containing 1
Name:nucleotide-binding oligomerization domain containing 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:107699.03
Organism:Homo sapiens (Human)
Description:gi_5174617
Residue:953
Sequence:
MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
CPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFSPSLLTQSKVV
VNTDPVSRYTQQLRHHLGRDSKFVLCYAQKEELLLEEIYMDTIMELVGFSNESLGSLNSL
ACLLDHTTGILNEQGETIFILGDAGVGKSMLLQRLQSLWATGRLDAGVKFFFHFRCRMFS
CFKESDRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTFDGLDELHSDLDLSRVPD
SSCPWEPAHPLVLLANLLSGKLLKGASKLLTARTGIEVPRQFLRKKVLLRGFSPSHLRAY
ARRMFPERALQDRLLSQLEANPNLCSLCSVPLFCWIIFRCFQHFRAAFEGSPQLPDCTMT
LTDVFLLVTEVHLNRMQPSSLVQRNTRSPVETLHAGRDTLCSLGQVAHRGMEKSLFVFTQ
EEVQASGLQERDMQLGFLRALPELGPGGDQQSYEFFHLTLQAFFTAFFLVLDDRVGTQEL
LRFFQEWMPPAGAATTSCYPPFLPFQCLQGSGPAREDLFKNKDHFQFTNLFLCGLLSKAK
QKLLRHLVPAAALRRKRKALWAHLFSSLRGYLKSLPRVQVESFNQVQAMPTFIWMLRCIY
ETQSQKVGQLAARGICANYLKLTYCNACSADCSALSFVLHHFPKRLALDLDNNNLNDYGV
RELQPCFSRLTVLRLSVNQITDGGVKVLSEELTKYKIVTYLGLYNNQITDVGARYVTKIL
DECKGLTHLKLGKNKITSEGGKYLALAVKNSKSISEVGMWGNQVGDEGAKAFAEALRNHP
SLTTLSLASNGISTEGGKSLARALQQNTSLEILWLTQNELNDEVAESLAEMLKVNQTLKH
LWLIQNQITAKGTAQLADALQSNTGITEICLNGNLIKPEEAKVYEDEKRIICF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM237
NameBDBM237
Synonyms:1,2,5-trimethyl-3-[(E)-2-(1-methyl-4-pyridin-1-iumyl)ethenyl]indole;hydroiodide | 1,2,5-trimethyl-3-[(E)-2-(1-methylpyridin-1-ium-4-yl)ethenyl]indole;hydroiodide | 1,2,5-trimethyl-3-[(E)-2-(1-methylpyridin-1-ium-4-yl)vinyl]indole;hydroiodide | 1,2,5-trimethyl-3-[(E)-2-(1-methylpyridin-1-ium-4-yl)vinyl]indole;iodide | MLS-0327351.0001 | cid_44620975 | sodium chloride
TypeSmall organic molecule
Emp. Form.C19H21N2
Mol. Mass.277.3829
SMILESCc1c(\C=C\c2cc[n+](C)cc2)c2cc(C)ccc2n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a