BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M1
LigandBDBM50258439
Substrate/Competitorn/a
Meas. Tech.Discovery of Novel Allosteric Modulators of the Muscarinic Receptor M5: Calcium Flux Assay
EC50 6040±n/a nM
Citation PubChem, PC Discovery of Novel Allosteric Modulators of the Muscarinic Receptor M5: Calcium Flux Assay PubChem Bioassay(2010)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Muscarinic acetylcholine receptor M1
Name:Muscarinic receptor M1 and M2
Synonyms:Cholinergic, muscarinic M1 | Chrm-1 | Chrm1 | cholinergic receptor, muscarinic 1
Type:Enzyme Catalytic Domain
Mol. Mass.:51390.46
Organism:RAT
Description:Cholinergic, muscarinic M1 CHRM1 RAT::P08482
Residue:460
Sequence:
MNTSVPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDSEAQAPTKQPPKSSPNTVKRPTKKGRDRGGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTVNPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50258439
NameBDBM50258439
Synonyms:1-(4-bromobenzyl)indoline-2,3-dione | CHEMBL523685 | VU0119498 | cid_3008304
TypeSmall organic molecule
Emp. Form.C15H10BrNO2
Mol. Mass.316.149
SMILESBrc1ccc(CN2C(=O)C(=O)c3ccccc23)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a